Verified memberOpen to offersChat enabled

firstclasscarvaleting.co.uk

Visit
SEO stats
RQS 350UV 151DA 1PA 16TF 0CF 3Refs 5Backlinks 5
30-day visits 345 Peak 47 on 03/08
18 Jul 2026: 17 hits19 Jul 2026: 8 hits20 Jul 2026: 4 hits21 Jul 2026: 14 hits22 Jul 2026: 0 hits23 Jul 2026: 1 hit24 Jul 2026: 4 hits25 Jul 2026: 7 hits26 Jul 2026: 16 hits27 Jul 2026: 6 hits28 Jul 2026: 5 hits29 Jul 2026: 8 hits30 Jul 2026: 12 hits31 Jul 2026: 11 hits1 Aug 2026: 21 hits2 Aug 2026: 19 hits3 Aug 2026: 47 hits4 Aug 2026: 21 hits5 Aug 2026: 8 hits6 Aug 2026: 6 hits7 Aug 2026: 4 hits8 Aug 2026: 22 hits9 Aug 2026: 7 hits10 Aug 2026: 3 hits11 Aug 2026: 16 hits12 Aug 2026: 21 hits13 Aug 2026: 28 hits14 Aug 2026: 0 hits15 Aug 2026: 1 hit16 Aug 2026: 8 hits
Last 30 days18 Jul - 16 Aug 2026

About firstclasscarvaleting.co.uk

Why it stands out

21 characters
1-word domain
No hyphens or numbers.
Clear buyer intent

Potential uses

Firstclasscarvaleting marketplacefirstclasscarvaleting directoryautomotive lead generationspecialist content site.

Domain facts

Platform: Domain LanderCategory: Automotive
Listed: 18 days agoRegistered: Unavailable
Extension: .co.ukDomain length: 21 characters
Word count: 1-word domainHyphens and numbers: No hyphens or numbers.
Primary keywords: Firstclasscarvaleting0 DomainUI members like this domain.
0 DomainUI members would pass on this domain.
Current Price No Buy Now price

What's included

firstclasscarvaleting.co.uk domain name

Domain only unless the seller agrees otherwise.

Buyer confidence

Ownership verified

Terms confirmed before payment

Guided transfer process

How buying works

  1. 1
    Agree the price

    Buy now or make an offer. Agree terms with the seller.

  2. 2
    Confirm secure payment

    Complete payment using the agreed safe payment method.

  3. 3
    Receive the domain

    Once payment is confirmed, the domain transfer can be started.